SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000017721 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000017721
Domain Number 1 Region: 25-301
Classification Level Classification E-value
Superfamily SET domain 3.27e-48
Family RuBisCo LSMT catalytic domain 0.0013
Further Details:      
 
Domain Number 2 Region: 331-469
Classification Level Classification E-value
Superfamily RuBisCo LSMT C-terminal, substrate-binding domain 0.00000000000122
Family RuBisCo LSMT C-terminal, substrate-binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000017721
Sequence length 472
Comment (Monodelphis domestica)
Sequence
MATAAKRPRVRKGRVEQGGGNSPLPDFLNWCRRVGLELSSKERAGGGEASGSRVPASSGL
QVSVTREGTVAGYGMVALEDVQRGELLFVVPRAVLLSQKTTAIRDLLEKEHGALQSQSGW
VPLLLALLYEYLAEDSPWSCYFSLWPDLGSLQHPMFWSEGELRQLLQGTGVPEAVQRDLA
NISQEYDAIVQPFLEAHPEIFPPQARSLELYRRLVAMVMAYSFQEPLEEEEDEKEPNPPM
MVPAADILNHVANHNANLEYSPEYLRMVATQPILKGQEIFNTYGQMANWQLVHMYGFAEP
YPGNTDDTADIQMVTVRAAALQGTTTEEERCLMCERWDFLCQLEMVGEEGAFVIGREEVL
TEEELSATLKVLCMPAKEFRELKEQDGWEEDDGDDSITLTNKTIPKLKASWKTLLRASIL
LTLQAYATDLKSEQELLSNKEAGAKLSWREEQALQVRYGQKRILHHLLELTS
Download sequence
Identical sequences F6U7C1
13616.ENSMODP00000017721 ENSMODP00000017721 ENSMODP00000017721

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]