SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000018210 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000018210
Domain Number 1 Region: 1-90
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.59e-24
Family Ubiquitin-related 0.00000981
Further Details:      
 
Domain Number 2 Region: 273-346
Classification Level Classification E-value
Superfamily XPC-binding domain 2.88e-20
Family XPC-binding domain 0.0000245
Further Details:      
 
Domain Number 3 Region: 176-232
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000000608
Family UBA domain 0.00064
Further Details:      
 
Domain Number 4 Region: 362-413
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000177
Family UBA domain 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000018210
Sequence length 415
Comment (Monodelphis domestica)
Sequence
MQITLKTLQQQTFKIDIDPEETVKALKEKIESEKGKDAFPVAGQKLIYAGKILNDDTALK
EYKIDEKNFVVVMVTKPKAAATSAPSPATTQQSIPATTSTVSSSTAASVAQAPTPSPALA
PTPTPTSVTPTPAAAVCEPIPTSAPKEEKPAEKPVEAPIGVSPTSSDSTLGDSSRSNLFE
DATSALVTGQSYENMVTEIMSMGYEREQVIAALRASFNNPDRAVEYLLMGIPGDRENQSV
VDPPQAASTGAAQSSAVAAAAATTTATTTTTTTHPLEFLRNQPQFQQMRQIIQQNPSLLP
ALLQQIGRENPQLLQLSSNAPQQISQHQEHFIQMLNEPVQESGGQGGGGGGSGGIAEAGS
GHMNYIQVTPQEKEAIERLKALGFPEGLVIQAYFACEKNENLAANFLLQQNFDED
Download sequence
Identical sequences 13616.ENSMODP00000018210

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]