SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000018980 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000018980
Domain Number 1 Region: 46-351
Classification Level Classification E-value
Superfamily L domain-like 1.02e-57
Family Ngr ectodomain-like 0.00038
Further Details:      
 
Domain Number 2 Region: 353-443
Classification Level Classification E-value
Superfamily Immunoglobulin 2.18e-16
Family I set domains 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000018980
Sequence length 650
Comment (Monodelphis domestica)
Sequence
MKLLWQVTVYHTWNAILLPIVYLTAQVWILCVAIAAAAAASAGPQNCPSVCSCSNQFSKV
VCTRRGLSEVPQGIPSNTRYLNLMENNIQMIQADTFRHLHHLEVLQLGRNSIRQIEVGAF
NGLASLNTLELFDNWLTVIPSGAFEYLSKLRELWLRNNPIESIPSYAFNRVPSLMRLDLG
ELKKLEYISEGAFEGLFNLKYLNLGMCNIKDMPNLTPLVGLEELEMSGNHFPEIRPGSFR
GLSSLKKLWVMNSQVSLIERNAFDGLASLVELNLAHNNLSSLPHDLFTPLRYLVELHLHH
NPWNCDCDILWLAWWLREYIPTNSTCCGRCHAPLHMRGRYLVEVDQASFQCSAPFIMDAP
RDLNISEGRIAELKCRTPPMSSVRWLLPNGTVLSHASHHPRISVLNDGTLNFSHVLLTDT
GVYTCMVTNVAGNSNASAYLNVSTAELNTSNYSFFTTVTVETTEISPEDTTRKYKPVPTT
STGYQPAYTTSTTVLIQTTRVPKVAVTTADTNDKMQTSLDEVMKTTKIIIGCFVAVTLLA
AAMLIVFYKLRKRHQQRSTVSAARTVEIIQVDEDIPATTAAAAPSSVSGEGAVVLPTIHD
HINYNTYKPAHGAHWTENSLGNSLHPTVTTISEPYIIQTHTKDKVQETQI
Download sequence
Identical sequences F7BVS9
XP_001366278.1.35504 ENSMODP00000018980 13616.ENSMODP00000018980 ENSMODP00000018980

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]