SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000019483 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000019483
Domain Number 1 Region: 284-528
Classification Level Classification E-value
Superfamily SIS domain 0.00000000000000512
Family mono-SIS domain 0.017
Further Details:      
 
Domain Number 2 Region: 29-185
Classification Level Classification E-value
Superfamily SIS domain 0.0000393
Family mono-SIS domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000019483
Sequence length 625
Comment (Monodelphis domestica)
Sequence
MPGTKRFQHVIETPEPGKWELSEYEASLPITEKSNPLTKDLDKANAEQIVQLLGQCDAEI
FQEEGSAMPAYQRWFLYLPIKERIFIFSLKTDLGNSYGYDPEGGLVVLSGGGTSGRMAFL
MSVSFNQLMKGLGQKPLYTYLIAGGDRSVVASREGTEDSALHGIEELKKVAAGKKRVIVI
GISVGLSAPFVAGQMDFCMSNPDIFLPVLVGFNPINMARNDPIEDWNSTFREIAEKMQKL
QEKQKAFVLNPAIGPEGLSGSSRMKGGSATKVLLETLLLAAHKTVDRGIAASQSCLLEIL
RTFERAHKVTYSQGTKIAALMKQASTRLLSKGRVYLVGWQTLGIIAIMDGLTFKTYFQDV
RGFLIGDHSDMFNRKEELIDQGPQFSFSQEDFLSSILPSLTEIDTVLFIFTLDDNLTEVE
TLVEQVKKKTPNIQALAHSTVGQYLPSPLKKLFPSIISITWPLLFFEYEGNFIQKFQREL
STKWVLNTVSTGAHVLRGKILYNHMLDLRLRNSKLFWRGLAMLQRFSGQPKAQCIKSLLK
AIHFPQEVSEEIQAAPISYHIQVAHEKEQVIPTALLTLLFRCSIPEAKTHLTASPSVCET
IKNILLRLGRKRSADSIDTLKMTIE
Download sequence
Identical sequences F6Z539
13616.ENSMODP00000019483 ENSMODP00000019482 ENSMODP00000019483

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]