SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000024766 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000024766
Domain Number 1 Region: 198-254
Classification Level Classification E-value
Superfamily PABC (PABP) domain 0.0000000000000113
Family PABC (PABP) domain 0.0003
Further Details:      
 
Domain Number 2 Region: 161-203
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000000000363
Family Canonical RBD 0.0094
Further Details:      
 
Domain Number 3 Region: 59-118
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000103
Family Canonical RBD 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000024766
Sequence length 286
Comment (Monodelphis domestica)
Sequence
VIAGDVGYDSSNDDDDYTFAANIINDGNIEKKEFLLVELRVGEGGDEHCCKQLPHDVPVV
SDLHSDGTKAMLCEKFSPAGPMLSLRVCRDMITSCSLEYANVNFQQPADAEHAPDTMNVG
IMCIWEHLVCKVVGDENGSKGYNVHSEIQDATDRVINDKTLSVKVMTDPTGKSKGFGFVT
FEKHEDAVKAGEEMNGKDINGKRTPQPAVLVQGQELLTASMLAAGPPQEQKQMSGEGLFP
LIQTMHNNLVGKITAEAHSDAPHPLLAKHKSATAITPLKQAADTLH
Download sequence
Identical sequences F6SA23
ENSMODP00000024766 13616.ENSMODP00000024766 ENSMODP00000024766

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]