SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000026091 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000026091
Domain Number 1 Region: 30-130
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000293
Family V set domains (antibody variable domain-like) 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000026091
Sequence length 300
Comment (Monodelphis domestica)
Sequence
DFGLHNFFSAPLTASLLAWWTVQQAWAGLLIEKIPETPQEGQDVLLTVHGVPAAIKDFNW
YQGEEVDGSTMIFSYFPGLPRPQRNGNALQGRNIIGFPNGSFLLRHVQLTDSGIYQVGIT
FNPSWIMRAKTELKASPVHKHQSGKHSSSAVNSGTLVAIVLGCVGLGALIVGGGLAYLMV
SRGWRIRSPGTLIHPPHRVAGRQVAHPCPRLPWATEKSWVGLLSSLGPRFLTDGSNIYEV
IHSPGILIAPTSVTGIINPNLTPDSPQTRNQEAEGHRYQLSTQELQDPDPAPYCQLAPTA
Download sequence
Identical sequences F6QGA4
ENSMODP00000026091 13616.ENSMODP00000026091 ENSMODP00000026091

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]