SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000027834 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000027834
Domain Number 1 Region: 33-121
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 2.47e-33
Family SCAN domain 0.00014
Further Details:      
 
Domain Number 2 Region: 493-550
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.78e-23
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 3 Region: 660-717
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.49e-21
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 4 Region: 832-889
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.85e-21
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 5 Region: 437-494
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.78e-20
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 6 Region: 916-974
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.06e-20
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 7 Region: 216-266
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.35e-19
Family KRAB domain (Kruppel-associated box) 0.0015
Further Details:      
 
Domain Number 8 Region: 612-661
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.27e-19
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 9 Region: 380-435
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.93e-19
Family Classic zinc finger, C2H2 0.0094
Further Details:      
 
Domain Number 10 Region: 702-754
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.14e-18
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 11 Region: 959-1011
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.81e-17
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 12 Region: 765-817
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.74e-17
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 13 Region: 539-591
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.83e-16
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 14 Region: 328-381
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000455
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Domain Number 15 Region: 880-911
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000299
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000027834
Sequence length 1020
Comment (Monodelphis domestica)
Sequence
MITRTTLDSGNHAMLKNKNDNWGRKSHRERNISSGPELFRQLFRQLRYQDTSGPQEALVR
LQELSRWWLRPDIHTKEEILDRLVLEQFLTILPGDTRTWVLLHHPENGKEAVALVKDVES
HFEEQEMEVAAPAQVQDGNLWMGTTSLGASQESLPRPSLGDHFSGRPPSDAATAHLQDPL
NGTCRPSPCGAPSASLAFHCPRPALSLSACVLDLERESMTFEDVAVYFSKAEWTLLSPAQ
QVLYRNVMLENYENLASLGDESQKENKKLAPARESAEADPEASSPGGLQTCAPQQPEFEE
SAEHDHNREKPGGNSALEIVTGEERGSSWDLLQHQKTHSGENSLPCGEVGSAFSHTSGSS
QAQRIKGENMPHKCKDCNKSFNHRSHLEHHQRLHTRERPYKCKECGKTFRWSSNFARHRR
IHTVPKHYECQECGKETFRHISTRNTHRKVHAGEKRYKCKECGKTFTRNRTLLDHQRIHS
GEKPYRCNDCGKTFTRNRTLVDHQRIHSGEKPYRCNNCGKTFTRNRSLVEHERIHTGERP
YECSKCGKAFNRKSYLFLHERTHNKKKPYKCDICGKDFRWGSGFARHRRSHTEEKYNEVN
EQRGVFPHGSDVQHQRIPTEEKSYECQECGKTFTRKRTLIDHQRIHSGEKPYECSQCEKT
FSCRPYLIAHQRTHIPKNYYKCSQCGKSFSQKSTLLIHQRLHTGERPYKCSVCGKAFRWK
SNFIQHQKRHPGMKQHKCQECGKVFSQKDILLAHQMIHKFQTREKVYKCNMCDKAFPKKS
QLIMHDRFHTRERPYRCNKCGKKFRWSSNLSRHQKSHIAEPNNYECQQCGKTFTRKGNLI
DHERIHTGERPYSCNECDKSFSRSRSLVSHQRVHMKGKLHECKDCGKTFTTNRSLVSHQR
IHSGAKVYECKDCGETFTRNRNLVVHQKTHTGEKEKHECEVCGKTFTRNRNLIEHGRIHT
GEKPYTCNQCGKAFVRKSYVLIHHRTHSRKKPYTCMVCGEAFMWKSGYSRHQLTHTKEEL
Download sequence
Identical sequences 13616.ENSMODP00000027834

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]