SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000028777 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000028777
Domain Number 1 Region: 199-343
Classification Level Classification E-value
Superfamily PH domain-like 2.34e-45
Family Third domain of FERM 0.00000026
Further Details:      
 
Domain Number 2 Region: 88-198
Classification Level Classification E-value
Superfamily Second domain of FERM 1.31e-38
Family Second domain of FERM 0.000000786
Further Details:      
 
Domain Number 3 Region: 498-586
Classification Level Classification E-value
Superfamily Moesin tail domain 1.05e-32
Family Moesin tail domain 0.0000249
Further Details:      
 
Domain Number 4 Region: 2-87
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.07e-26
Family First domain of FERM 0.00000756
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000028777
Sequence length 586
Comment (Monodelphis domestica)
Sequence
MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWYFGLQYVDNKGFPTWLK
LDKKVSAQEVRKESPLQFKFRAKFYPEDVPEELIQDITQKLFFLQVKDGILSDEIYCPPE
TAVLLGSYAVQAKFGDYNKEVHKSGYLGSERLIPQRVMDQHKLSREQWEDRIQVWHAEHR
GMLKDNAMLEYLKIAQDLEMYGINYFEIKNKKGTDLWLGVDALGLNIYEKDDKLTPKIGF
PWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILQLCMGNHELYMRRRKPDTI
EVQQMKAQAREEKHQKQLERQQLETEKKRRETVEREKEQMLREKEELMMRLQDYEQKTKK
AEKELSDQIQRAIQLEEERKRAQEEAERLEADRVAALRAKEELERQAVDQIKSQEQLAAE
LAEYTAKIALLEEARRRKEDEVEEWQIRAREAQDDLVKTKEELHQVMTAPPPPPPPVYEP
VNYHVHENLQDEGTEYSGYSAEFSSEGIMDDRNEEKRITEAEKNERVQRQLQTLTNELSQ
ARDENKRTHNDIIHNENMRQGRDKYKTLRQIRQGNTKQRIDEFEAM
Download sequence
Identical sequences F7C4V4
XP_001372743.1.35504 XP_007484900.1.35504 XP_007484901.1.35504 ENSMODP00000009488 ENSMODP00000028777 13616.ENSMODP00000028777 ENSMODP00000009488 ENSMODP00000028777

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]