SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000028829 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000028829
Domain Number 1 Region: 74-135
Classification Level Classification E-value
Superfamily RuvA domain 2-like 0.000000000545
Family ComEA-like 0.042
Further Details:      
 
Weak hits

Sequence:  13616.ENSMODP00000028829
Domain Number - Region: 196-290
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.0432
Family Mitochondrial resolvase ydc2 catalytic domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000028829
Sequence length 370
Comment (Monodelphis domestica)
Sequence
KHMNSNELCDPFFSILGKWKHFPVMMCPSLYHSLHMSCCQRKSIAPVKKTDFVSVSSDES
LKDTGKRLEDLYSSEEKSAILQVLNTASVNELGAFTFLRGRKSINIVKHREKHGPFQDLE
SLMEVPLFQYKSTVKVCDSILHPESKEKKKEKKILENSLGKFVRLGIERKKLKAAKSIVS
IVFGNERIAWAHLDNTVMVLDWRQENNFKLMKETYMPAMYLKMISSVVSKIPEADFYILE
KRTFSLQQTTLFPVTLHFHIVEAMLYSLLNKTFAQDGQHRVLSMNRNVVGKHFDLMLGTM
RTSGMALVQQFLSDFPKQEKPRVSFPLENLVRYRSMMETDGRKIKEELWDSLLQAVAFYE
LFIEGGERKC
Download sequence
Identical sequences F7FMN3
ENSMODP00000028829 ENSMODP00000028829 13616.ENSMODP00000028829

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]