SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000031113 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000031113
Domain Number 1 Region: 217-274
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.05e-28
Family Classic zinc finger, C2H2 0.0025
Further Details:      
 
Domain Number 2 Region: 273-330
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.09e-26
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 3 Region: 329-386
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.99e-26
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 4 Region: 55-106
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.09e-21
Family KRAB domain (Kruppel-associated box) 0.0019
Further Details:      
 
Domain Number 5 Region: 375-427
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.27e-20
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 6 Region: 170-218
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000203
Family Classic zinc finger, C2H2 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000031113
Sequence length 447
Comment (Monodelphis domestica)
Sequence
KTGVPEHLMETQADCVSQEPQLLRESAPLSPKVPASLNEGNLGDQMLAISLLKAKSQELV
TFEDVAVYFIRKEWKRLDPAQRDLYRDVMLENYGNVFSLDGETRTQNDQDISEAAESHGV
MLGRFQKDVPSSLKFGEACEWEGNLERQLGNSMEERLRRKMGDFRQVIVEDQKIPTGERV
QQYKEFGNSFSLNSNLVIHQRGSVGDKPHKCDECGKSFNRTSDLIQHQRIHTGEKPYECN
ECGKAFSQSSHLIQHQRIHTGEKPYECNDCGKTFSCSSALILHRRIHTGEKPYECNECGK
TFSWSSTLTHHQRIHTGEKPYECNECGKAFSRSSTLIHHQRIHTGEKPYECNECGKAFSQ
SSHLYQHQRIHTGEKPYECRECGGRFTYSSGLIQHQRIHTGENPYECSECGKAFRYSSAL
VRHQRIHTGEKSLNVMTMGKGSIRVAA
Download sequence
Identical sequences 13616.ENSMODP00000031113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]