SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000032356 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000032356
Domain Number 1 Region: 28-82,110-169
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000387
Family Spermadhesin, CUB domain 0.01
Further Details:      
 
Domain Number 2 Region: 175-207
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000144
Family LDL receptor-like module 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000032356
Sequence length 221
Comment (Monodelphis domestica)
Sequence
FLKLSPSLLLLGAFILEASALEVVNLVDFCGQMLRGEGMIIRSHSDSRKFYFVALETDCW
LTVQAASPQDRILFQFRFFLVYSLTQPSSSELPQITTSGLPSHLREDPCTTGSYVQFYDG
SKEGPHLGKPLCGMTIPGPVLSTGRSLSLRLVTRGQQPRVDFIGDFTSFRLGTLGDYFLC
RNKKCIPQSLVCDVWGIDNCGDGSDQTAYHPASCRGPSPVP
Download sequence
Identical sequences F7A6C2
ENSMODP00000032356 ENSMODP00000032356 13616.ENSMODP00000032356

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]