SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000034153 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000034153
Domain Number 1 Region: 184-458
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.48e-85
Family Eukaryotic proteases 0.0000000331
Further Details:      
 
Domain Number 2 Region: 21-82
Classification Level Classification E-value
Superfamily GLA-domain 5.72e-20
Family GLA-domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000034153
Sequence length 484
Comment (Monodelphis domestica)
Sequence
SIVFLGQQQALSVLRRTRRANKGFLEEMRKGNLERECLEEVCSYEEAFEALESAPVTDAF
WTKYQICGSLRPSRDTFDACLQGEEGADSPVSGLLGQRADQLGEGRAAPAEEEGELVTGQ
SGWSKGSRAGPSTASGASSPLRHLPFGRLRPCCPHTPSSPPNPKSLLSAGSSSGHFHLFF
NSPPPSMDNDEKHLLNSYLGGRIVHGHNVEPGTAPWQVMLFRQRPQEMLCGASLISDRWV
LTAAHCIFYPPWDKNYTVQDLLVRIGKHQRAKYERPIEKIAKLEKVIIHPKYNWKENLDR
DIALLKLKNPITFSDYIHPICLPSKEMVQKLFLSGHKGRVTGWGNLKETWTSTKENLPEI
MQKISLPIVEQNLCRASTRIKITDNMFCAGKFGGGPRRGPRDSCEGDSGGPFVMKNPFDK
RWYQMGIVSWGEGCDRDGKYGFYTHVFRLKKWIQKAIDKVAPLPLSTRASQSSPLCPEVN
GSAS
Download sequence
Identical sequences F7CZN2
ENSMODP00000034153 13616.ENSMODP00000034153 ENSMODP00000024823

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]