SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000035467 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000035467
Domain Number 1 Region: 38-130
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 2.29e-41
Family SCAN domain 0.0000473
Further Details:      
 
Domain Number 2 Region: 508-564
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.18e-25
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 3 Region: 563-618
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.7e-22
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 4 Region: 469-521
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.22e-19
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 5 Region: 231-292
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.2e-18
Family KRAB domain (Kruppel-associated box) 0.0029
Further Details:      
 
Domain Number 6 Region: 610-636
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000462
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000035467
Sequence length 638
Comment (Monodelphis domestica)
Sequence
MATALGLKVQSPLEQEEILIVKVEEDFPWEEEPPSQRNDPSPETFRQLFRLFCYQEVAGP
REALSRLWELCCRWLRPEMRTKEQILELLVLEQFLTVLPGEIQTWVREQHPESGEEAVVL
VEGLQREPKKQRQWITVSLPGKEEIAQKSLIFQGAVQHEAMAQEEGTQNSCLGPREQPNR
RSKKNPQLRPKRGEKLPFFGKERSSPTSRISALFREESTRDQGTATAFISAWSQMPVTFE
DMAMYLSQEEWGRLNPEQREHYQNVLQENYGNIIMPRLPALKPNLIAQMERKEGLWNSNV
PAFKERDVPRDNPTGEETGNNRFSVIMEVWVLKILYLSYIMSPSLPVDSLPPIQSTAKKT
PIFMTFPHLIILLSYLTSALCTPLMHSFVFCHLCIRLITPSRLYTPEGHKQCLTCFWKSK
GCGHQPAHQGQACVTRSEWHQGYPPLERESQTCVQERDIGLQRACIVEKPYKCLECGKSF
NKSSHLIKHQRTHTGEKPYKCLVCGKGFSDRSNFSTHQRIHTGEKPYKCNECGKCFSQSS
SLVIHRRTHTGERPYKCGECGKSFNNSSHFSAHRRTHTGEKPYMCQNCGKSFRRGTDLNK
HQRTHTGERPYKCAVCGKSFTRKHQLVTHQEIHEGENN
Download sequence
Identical sequences 13616.ENSMODP00000035467

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]