SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000036273 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000036273
Domain Number 1 Region: 1-674
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.21e-238
Family Motor proteins 0.00000000000000474
Further Details:      
 
Domain Number 2 Region: 672-797
Classification Level Classification E-value
Superfamily Myosin rod fragments 3.31e-22
Family Myosin rod fragments 0.00032
Further Details:      
 
Domain Number 3 Region: 792-908
Classification Level Classification E-value
Superfamily Myosin rod fragments 5.93e-21
Family Myosin rod fragments 0.001
Further Details:      
 
Domain Number 4 Region: 1077-1185
Classification Level Classification E-value
Superfamily Myosin rod fragments 1.83e-17
Family Myosin rod fragments 0.0032
Further Details:      
 
Domain Number 5 Region: 895-987
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00000000119
Family Myosin rod fragments 0.0037
Further Details:      
 
Domain Number 6 Region: 1351-1463
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00000000602
Family Myosin rod fragments 0.0011
Further Details:      
 
Domain Number 7 Region: 1185-1286
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00000000628
Family Myosin rod fragments 0.0078
Further Details:      
 
Domain Number 8 Region: 1595-1696
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0000114
Family Regulator of G-protein signaling, RGS 0.0081
Further Details:      
 
Weak hits

Sequence:  13616.ENSMODP00000036273
Domain Number - Region: 1462-1579
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0366
Family Myosin rod fragments 0.01
Further Details:      
 
Domain Number - Region: 993-1067
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0628
Family Myosin rod fragments 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000036273
Sequence length 1796
Comment (Monodelphis domestica)
Sequence
GESGAGKTENTKKVIQYLAYVASSHKSKKDQVSKGLSLALGELERQLLQANPILEAFGNA
KTVKNDNSSRFGKFIRINFDVNGYIVGANIETYLLEKSRAIRQAKEERTFHIFYYLLSGA
GEHLKTDLLLEPYNKYRFLSNGHVTIPGQQDKDMFQETMEAMRIMSIPEEEQMGLLKVIS
GVLQLGNIAFKKERNTDQASMPDNTAAQKVSHLLGINVTDFTRGILTPRIKVGRDYVQKA
QTKEQADFAIEALAKATYERMFRWLVMRINKALDKTKRQGASFIGILDIAGFEIFDLNSF
EQLCINYTNEKLQQLFNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIDLIEKPAGPPGI
LALLDEECWFPKATDKSFVEKVVQEQGTHPKFQKPKQLKDKADFCIIHYAGKVDYKADEW
LMKNMDPLNDNIATLLHQSSDKFVSELWKDVDRIIGLDQVAGMSETALPGAFKTRKGMFR
TVGQLYKEQLSKLMATLRNTNPNFVRCIIPNHEKKAGKLDPHLVLDQLRCNGVLEGIRIC
RQGFPNRVVFQEFRQRYEILTPNSIPKGFMDGKQACVLMIKALELDSNLYRIGQSKVFFR
AGVLAHLEEERDLKITDVIIGFQACCRGYLARKAFAKRQQQLTAMKVLQRNCAAYLKLRN
WQWWRLFTKVKPLLQVSRQEEEMMAKEEELVKVKEKQLAAENRLTEMETLQSQLMAEKLQ
LQEQLQAETELCAEAEELRARLTAKKQELEEICHDLEARVEEEEERCQHLQTEKKKMQQN
IQELEEQLEEEESARQKLQLEKVTTEAKLKKLEEDQIILEDQNCKLAKEKKLLEDRISEF
TTNLTEEEEKSKSLAKLKNKHEAMITDLEERLRREEKQRQELEKTRRKLEGDSTDLNDQI
AELQAQIAELKMQLAKKEEELQAALARVEEEAAQKNMALKKIRELESQISELQEDLESER
ASRNKAEKQKRDLGEELEALKTELEDTLDSTAAQQELRSKREQEVNILKKTLDDEAKTHE
AQIQEMRQKHSQAVEELAEQLEQTKRVKANLEKAKQALESERAELSNEVKALLQGKGDSE
HKRKKVETQLQELQVKLTEGERVRTELADKVTKLQVELDNITGLLNQSDSKSSKLAKDFS
ALESQLQDTQELLQEETRQKLSLSTKLKQTEDEKGTLREQLEEEEEAKRNLEKQIATLHA
QVVDMKKKMDDGVGCLESMEETKRRLQKDLEGVSQRYEEKAAAYDKLEKTKTRLQQELDD
LLVDLDHQRQIVSNLEKKQKKFDQLLAEEKTISAKYAEERDRAEAEAREKETKALSLARA
LEEAIEQKAELERLNKQFRTEMEDLMSSKDDVGKSVHELEKSKRALEQQVEEMKTQLEEL
EDELQATEDAKLRLEVNLQALKAQFERDLQGRDEQSEEKKKQLVRQVREMEAELEDERKQ
RSVAVAARKKLEMDLKDLEAHIDSANKSRDEAIKQLRKLQAQMKDYMRELDDTRASREEI
LAQSKENEKKLKSMEAEMIQLQEELAAAERAKRQAQQERDELADEIANSSGKGALALEEK
RRLEARIAQLEEELEEEQGNTELINDRLKKANLQIDQINTDLNMERSHGQKNENARQQLE
RQNKELKVKLQEMESTVKSKYKASITALEAKIAQLEEQLDNETKERQAACKQVRRAEKKL
KDVILQVDDERRNAEQYKDQADKVTVRLKQLKRQLEEAEEEAQRANASRRKLQRELEDAT
ETADAMNREVSSLKNKLRRGDLPFVVPRRVARKGPGECSDEEVDGKADAGDAKATE
Download sequence
Identical sequences 13616.ENSMODP00000036273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]