SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000036498 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000036498
Domain Number 1 Region: 214-328
Classification Level Classification E-value
Superfamily Acid proteases 1.13e-26
Family Retroviral protease (retropepsin) 0.012
Further Details:      
 
Domain Number 2 Region: 5-86
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.95e-16
Family Ubiquitin-related 0.0000808
Further Details:      
 
Weak hits

Sequence:  13616.ENSMODP00000036498
Domain Number - Region: 129-169
Classification Level Classification E-value
Superfamily XPC-binding domain 0.0288
Family XPC-binding domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000036498
Sequence length 369
Comment (Monodelphis domestica)
Sequence
MLLTVYCVRRDSTEMTFSLQVDRDFELHNFRVLCELESGIPADETHIVFAENSLEDNHRS
LASYGLKDGDVVILRQKANERAGSPGQFTGIDFSSIAVPGPSGTSRSPHQMQPPLSSGNV
VQVAESPAALRDMLLSNPHELAVLRERNPSLAEALFSGDLEEFTRVLIEQQEDQALRDEE
RFRLYVADPFDLEAQAKIEEAIRQQNIEENMSIAMEEAPESFGQVVMLYINCKVNGHPVK
AFVDTGAQMTIMSQACAIRCNILRLVDRRWAGIAKGVGTQKIIGRVHLAQVQIEGDFLAC
SFSIIEEQPMDMLLGLDMLKRHQCNIDLKKNVLVIGTTGTHTAFLPERELPECARLAYDP
GQDDLRMEE
Download sequence
Identical sequences F6XNN8
ENSMODP00000036498 ENSMODP00000036498 13616.ENSMODP00000036498

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]