SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000036689 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000036689
Domain Number 1 Region: 875-1085
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.44e-54
Family DBL homology domain (DH-domain) 0.0003
Further Details:      
 
Domain Number 2 Region: 1248-1434
Classification Level Classification E-value
Superfamily PH domain-like 1.48e-26
Family Pleckstrin-homology domain (PH domain) 0.00000656
Further Details:      
 
Domain Number 3 Region: 1074-1194
Classification Level Classification E-value
Superfamily PH domain-like 1.16e-24
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000036689
Sequence length 1438
Comment (Monodelphis domestica)
Sequence
LSFFLETKKPPLAPKPKFLVGSKPTPPPIAPKPDVVVSNVLLSTRTSKPAIAPKPKVPKG
SPLPDTRQSPSRKNRFPLEEHKQESSEHSDKLKCQNGEDKRTSYIMPVCSSNTECILNHG
KGDNSYVKHIVLEHLETLENLENIGVGDPLSVPKAKQKCDAQSEKVGNRNRVILKASLLE
EKLKDVFFTSSGSSPASSPLKHRSTDCLEMDGSCDANRQFNIEIVSLSQSLSGFEEAIPQ
TQNCCVKFPGDGTQMLETNQDEPETSINGITCLPEQEAMENSQVNSVPEESSPKSEIKNI
VPSGKSLEPCNKIFPTPKPRMPRTTRLIRQGYVDTPSESMEELSHSQSDSSPLIEHVKKS
DQTVLLGTDIVCNHEPVENEEQENKNELTPDSGNRKCPNLTACDDQDVAIYQNVFLQASH
KDKIDENRPPTDFNFYPEGNTIDEATISSNMDRKTSFTKCSKQSMSLPTNLKPTYSQHLP
APSHPGGSPSKTAQEAAIGDESPIKVAPKKPQRHSLPAAGRLKKAASVELLENSSYPSDE
EKSSEGILGKTCLRHLAAKEHGISSSFDVPKLIKTSEKPVWKLPHPILPFPGNQESLKST
NSEVFPSLTKPRAKSLSAMDMDRCNKPCKDPQKKNSLKKLLNMKLSICFTKSDFQRFLSK
SSQVGEATPGRPSSREGRGIDHGQQGMSSVDEKKGKPVKAHSAETHSPASHKKRRMYRSQ
VDLPNGPKAESLDDQMLSREGTPSTPSNSGASNCAPEYENICRYEETPEYENLPFTMATR
RTPDSEWQNTRVLEDSDANVYEIEEPYVALNSQLQQAPGPLHSRNGSRKGEDNQGGLDLP
SDEEEAVNSSDEDASSDSSKGEPDLLEDKQGKGTGKRSKVYHIAKEIMSSEKVFVDVLKL
LHIDFRDAVAQASRQLGKPVIEDRILNQILYYLPQLYELNRDLLKELEERMLNWTEQQRM
ADIFVKKGPYLKMYSTYIKEFDKNVALLDEQCKKNPGFAAVVKDFEMSPRCANLAIRHYL
LKPVQRIPQYRLLLTDYLKNLLEDSADYRDTQDALAVVIEVANHANDIMKQGDNFQKLMQ
IQYSLTGHHEIVQPGRVFLKEGTLMKLSRKVMQPRMFFLFNDALLYTTPLQAGMYKLNNM
LSLAGMKVRKPTQEAYQNELKIESVERSFILSASSATERDEWLEAISQSIEEYAKKKITF
CPSRSLDETDTAKKEEMSPLGSKAPIWIPDTRATMCMVCTSEFTLTWRRHHCRACGKIVC
QACSSNKYGLDYLKNQPARVCEHCFRELQKLDHQNSPKMGSPANHKSPSSALSSVLHSIP
SGRKQKKIPAALKEVSANTEDSTMSGYLYRSKGSKKPWKHFWFVIKNKVLYTYAASEDVA
ALESQPLLGFTVTEVQDENSQSKVFQLLHKNVLFYLFKADDAHSAQKWIEAFQEGTVL
Download sequence
Identical sequences 13616.ENSMODP00000036689

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]