SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000036881 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  13616.ENSMODP00000036881
Domain Number - Region: 16-194
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.00167
Family Hermes transposase-like 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000036881
Sequence length 217
Comment (Monodelphis domestica)
Sequence
FSLVLESNDVRDSAQLLIFIHGTNDNFKVTEELAALQSIKVTTTGEDIYEKVSQTVKDLE
LDWSKLARVTIDDAPSMVGSKKGMDKHNHSHPIAIHQKLCSKSLKWNSVMKIVVSCVNFL
RAHVLNHRQFQKFLSELNVAYEDVLYHTEFHWLSRGRVLRHFYDLLPQITAFMLSKKKVP
ELNDAEWKWHLAFLTDRCNRTTQQFQCATSRKREAHL
Download sequence
Identical sequences F6UP90
ENSMODP00000036881 ENSMODP00000036881 13616.ENSMODP00000036881

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]