SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000038269 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  13616.ENSMODP00000038269
Domain Number - Region: 73-140
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000229
Family V set domains (antibody variable domain-like) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000038269
Sequence length 194
Comment (Monodelphis domestica)
Sequence
MKIDILLFVLLCLQAKVLAENFNDSAQLMVIEFYNGGLKLSCHYPEAARDFKMQLLKGTG
KQKVCELKKENQDVQMTKELVSCQPKLSNTSVIFFLTDLDSTHTGHYFCSLHVTYPPPFL
NSTPNGAYLHIYESKSCFHMSLWLSLGVAFSLCFIGILIGVFSNCIRKKISQSRSSLHET
NSEYMPMAAVNAAK
Download sequence
Identical sequences F6QZ18
13616.ENSMODP00000038269 ENSMODP00000038269 ENSMODP00000038269

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]