SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 150340.VEA_001489 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  150340.VEA_001489
Domain Number 1 Region: 80-399
Classification Level Classification E-value
Superfamily Subtilisin-like 1.31e-80
Family Subtilases 0.00000198
Further Details:      
 
Domain Number 2 Region: 437-523
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000196
Family Collagen-binding domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 150340.VEA_001489
Sequence length 534
Comment (Vibrio Ex25)
Sequence
MLKKLLSCCITSALCFHSSLAFSQPNEIADSAELQQAPDTLPATLMLAPDDIAIADRYIV
VFQQPQMMASSSPEFEQFTQQSVDRMSGLYSIKVESVFDHSISGFVANLSPEQLQDLRSD
PRVDYIEQDRILSLDPIVSADANQTNAIWGLDRIDQRNLPLDNNYSANFDGTGVTAYVID
TGVNNAHVEFGGRSVSGYDFVDNDADASDCNGHGTHVAGTIGGSLYGVAKNVNLVGVRVL
SCSGSGSTSGVIAGVDWVAANASGPSVANMSLGGGQSVALDSAVQSAVQSGVSFMLAAGN
SNADACNYSPARVATGVTVGSTTSTDARSSFSNWGSCVDVFAPGSQIKSAWYDGGYKTIS
GTSMATPHVAGVAALYLQENSSLSPSQVEALIVSRATSGKVTDTRGSVNKLLYSLTDADC
GQDCGGPDPTPDPEGKLTSGVPVSGLSGSTGQVAYYYVDVEAGQRLTVQMYGGSGDADLY
LRFGAKPTLNAWDCRPFKYGNNETCTVSATQSGRYHVMIQGYSNYSGVSIQASY
Download sequence
Identical sequences A7K1T6
gi|262396784|ref|YP_003288637.1| 150340.VEA_001489 WP_006742030.1.43605 WP_006742030.1.82618

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]