SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 15368.BRADI1G02440.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  15368.BRADI1G02440.1
Domain Number 1 Region: 488-779
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.09e-77
Family Protein kinases, catalytic subunit 0.00018
Further Details:      
 
Domain Number 2 Region: 80-169
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 2.36e-20
Family alpha-D-mannose-specific plant lectins 0.0031
Further Details:      
 
Weak hits

Sequence:  15368.BRADI1G02440.1
Domain Number - Region: 217-272
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.095
Family alpha-D-mannose-specific plant lectins 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 15368.BRADI1G02440.1
Sequence length 862
Comment (Brachypodium distachyon)
Sequence
MRTLWGGEDLAFLLRCCSLLLLLASFSHGADMPTGSSLSPGNQAAPWLSPNSTFSLAFAP
SPSSPSLFVAAVTYAGGVPVWSAGAGAAVDSGGSLRLSSTGDLQLVNGSGAVLWSSGTGG
RGVAAAALQESGNLVLKNSTGGALWQSFEHPTDTVVMSQSFTSSMNLTSGNYAFAVDRPS
GNLTLRWSSSSSGSGGGNAVKYFNKGYNSTFTGNQTLTSPSLVMQSNGIVSLTDTSLSSP
AVVAYSSNYGESGDMLRFVRLDADGNFRAYSAARGSSSATEQWSAVVDQCEVFGYCGNMG
VCGYNGTSPFCSCPSQNFRPKDAADPRSGCERKVELVNCPGNSTMLELANTQFLTYPPEI
TTEQFFVGITACRLNCLSGGSCVASTALADGSGLCFLKVSPFVSAYQSASLPSTSFVKVC
FPGVPNPPLVAGGGSSGGSSGLRAWVVALVVLGAVSGLVLCEWVLWWVFCRNSPKYGPAS
AQYALLEYASGAPVQFSYKELQRSTKGFKEKLGAGGFGAVYRGVLANRTVVAVKQLEGIE
QGEKQFRMEVATISSTHHLNLVRLIGFCSEGRHRLLVYEFMKNGSLDAFLFAGADAPKMP
WSTRFAVAVGTARGITYLHEECRDCIVHCDIKPENILLDEQHNAKVSDFGLAKLINPKDH
RHRTLTSVRGTRGYLAPEWLANLPITVKSDVYSYGMVLLEIVSGHRNFDISEETDRKKFS
VWAYEEYEKGNIACIVDKRLAEEDIDMAQAERALQVSFWCIQEQPVQRPTMGKVVQMLEG
IMELERPPPPKSSDSFLTVTTATGSTSGASSSMASTFASSALVAPMSTPNLEQQMAVGRS
ASVRDREIASHPLRSSEPYMTM
Download sequence
Identical sequences I1GL44
15368.BRADI1G02440.1 EG:BRADI1G02440.1 XP_003562797.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]