SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 15368.BRADI1G68410.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  15368.BRADI1G68410.1
Domain Number 1 Region: 99-187
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00000089
Family alpha-D-mannose-specific plant lectins 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 15368.BRADI1G68410.1
Sequence length 293
Comment (Brachypodium distachyon)
Sequence
MELVSCIITCLSLAFLLPSYTTATAPTGMIERETKQQILASIPPHWQENPVLFLTSPSGK
YAAYFMRSQTVPGAGGLGADFCYVEVLDTTEPGAEGRSVWESECLAVSTVNTCALVFSWK
GLEVFDGSNSVWHTHDTESDDNNFLKTLQLADEGDMRVLDKGGELAWKASDEPRAAQHCG
LPGSPGLAPAMPPFAEPVGQGSSNLPFGQEQGGNGNGYNGVAQPELPLAPLPEAAGLGGV
AAQGQVVGETIGFGSQPLVDNSPYDSGAPKHRSSLLGIGLAWGLSVAIACLGL
Download sequence
Identical sequences I1H7J4
XP_003558378.1.954 EG:BRADI1G68410.1 15368.BRADI1G68410.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]