SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 15368.BRADI4G29820.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  15368.BRADI4G29820.1
Domain Number 1 Region: 159-315
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.25e-31
Family Thioltransferase 0.00056
Further Details:      
 
Domain Number 2 Region: 44-152
Classification Level Classification E-value
Superfamily TPR-like 1.21e-23
Family Tetratricopeptide repeat (TPR) 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 15368.BRADI4G29820.1
Sequence length 319
Comment (Brachypodium distachyon)
Sequence
MEKVGENSFEDEIMESDIELEGEVFEPDNDPPQKMGDPSVEVSDENRDKAQLYKKEGLDA
LSEGKLIEAVECLTDGILLNPTSAILYATRAGVFMKMKKPNAAIRDADAALQINPDSAKG
YKSRGMAKAMLGKWEDAAHDLHLAAKLDFDEEICSELKKVEPNVHKIEEHRKKYERLRKE
REVKKADMERQRKQAEEVSAASAVVKDGEVITVHSSNELETKLKAASSLSRLVILYFTAT
WCGPCRLMGPVYKSLAEAHRNVVFLKVDIDELGIVAHRWNVSSVPTFSCVINGKEIDKVV
GADKASLERKIAQHGSSKK
Download sequence
Identical sequences I1IPZ3
15368.BRADI4G29820.1 EG:BRADI4G29820.1 XP_003578089.1.954 XP_010238150.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]