SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 164328.JGI74746 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI74746
Domain Number 1 Region: 179-244
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000179
Family RING finger domain, C3HC4 0.012
Further Details:      
 
Domain Number 2 Region: 73-94
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000183
Family CCCH zinc finger 0.003
Further Details:      
 
Weak hits

Sequence:  164328.JGI74746
Domain Number - Region: 119-139
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000113
Family CCCH zinc finger 0.0054
Further Details:      
 
Domain Number - Region: 270-297
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00114
Family CCCH zinc finger 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI74746
Sequence length 377
Comment (Phytophthora ramorum)
Sequence
MRRSEARSRYSTFSSVRSASNERERMFDNLQRRLTAQDLSDRGMVMGEDYEEKHSVSSTT
RSGPASVAAAPTTTLCRFFVLGKCRYGSRCTFSHVLPAQVGECAADETDGLSAAAALVDC
PFFLRGNCKYGEHCRLRHNPAMLQGAAAAAGARSALRATRASGYSAAINSTATSAEAANR
DDNQQDFMCGICFDDIVQSGKHFGLLSCDHCFCLDCLRSWRQSKDMELEVIRACPACRVP
SDFIVPSLIFCKGEEKRKVVEAYKSHLALRECKYFNGLFGSCPFGPRCFYAHRDGEGRDV
KHLDRPKRSTKPRRNRNSRQGGDAALQSLLQQYSHLFRFFEVAAWDDFDLVGGLYDSDES
DDDYFEYGFSDDDYDTE
Download sequence
Identical sequences H3GG35
jgi|Phyra1_1|74746|fgenesh1_pg.C_scaffold_9000149 164328.JGI74746

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]