SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 164328.JGI77113 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI77113
Domain Number 1 Region: 407-577
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.000000000000103
Family WD40-repeat 0.029
Further Details:      
 
Domain Number 2 Region: 1685-1862
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000732
Family Pentraxin (pentaxin) 0.079
Further Details:      
 
Domain Number 3 Region: 546-714,750-789
Classification Level Classification E-value
Superfamily NHL repeat 0.0000201
Family NHL repeat 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI77113
Sequence length 1930
Comment (Phytophthora ramorum)
Sequence
MADLRLTMISPSQSPSASPTAASFESTDPASDLTKTFLEFYGWSHVVGASDGETSLRKLG
GGFAVDCPLALEWDTTTQTMCALVYPTSIKIIRFNIATTGAQTSQAVGDIPTMECLHEIP
TPSPALSLHWVHHTLFFTTEDEVKCSVISRTRCFTLALASRWVLNEASCATQLSDDDLNQ
FPRPQIFPAGASTILGERDQKLVLGGPLHAVHILDLSNRVLQCAMLVTAGSINQAAELAQ
LLCPAATQWLGAVFEAFGYAEEALRLLPGLSLSLKVNMCIKHAQLEQLSKLLAELIEQER
DSLNLTGSSLFQRACIALHRGGMEASLKQLGSALLARKRFNDAIFVASLLQNEEQSLMML
DSSRLTARSLSSLDASHTWSLFTMVVLAPRKDPLAVIDGPTTSGAANGEQFVERVVFHPS
RGSVVCVKGDTLEELDVVTGALLCHITFDLLTTSSMDLILPAGSHFVVGLLQSRFLVVWD
LDDAVLLATTDVDKVHSSRRVTALATSLCADRWLFFNAEGSNNVRVTRVDSQRPAREILR
KSALRGGSVVSLAYSTEHRLLSSGCNDGTIQVWSISSDEVDASTGRKGQETTDFATPLFA
VQLVQSPVVEITIGICTGCGANGSSSNLFLAAGYQNRRVDVVAMNGQAHTCVASTTLASS
HTMDFSRISGTLTLAIHAQLPVLLAYWRSSRSEYGLDVIAAWELVHGGNLVTSPRGGAGG
NNSGGGAMTDWWPVANSLALRGRYTRPNDNEAPVVLATDITLWQNSLAVYASTAERRVLF
LIDVQQNQSPASTTESEPKSVLALSTTTQLTLAQYHDYPTGLPSSQLQIAVKTSAKGNPV
LKLQRFSQLSGRLTGSSDQLPDWKSERGVPLVPFQVLGNSHQSAVCIKLRERGEDAATNG
VRPSSFSFAVLDLDVMVDAAMSDVVIEPDDEGGAVSHTSLPAIELKDGALQHDARDACFA
MMPPTANVDALKSPAYLLLVLSKAGDVLNLMTTRDPSTDRRVKLNLPVQRIFATPLELPT
SSPFRSLVVCKLLYLLGSTGHEQLVLSTEDLSVPVENSSSWTCGSNERIVDAQWNSSACP
QIGPHDTQQRLLLAVTTTRRVVVLSPELRALRVYDFKNDLMGSPESLLWVSQTLLYATTG
NQVRFVTPVANHLRNDTSRLLCSIATELDTRPGFTRPTIQLVSLCGDRLCYAVSNPLTLS
SRATLHSVALCEPLLLGFAEPTATLRRVFEREMVAFTFMNDDSDRPVCSISDAVLETAYH
AFGWKDKVLKVLKALISSHEKSSAAVGAADGGALPAAPSSNYNRTSLLSRAVMSSILLDS
HRWEEFLRVFLAHDPALEEYVVAIDSDGAAKLPSRTGPTARRFRQLAAVFESIGQSDWAM
RCLDLSGDDEALLTMLRKFNAAASSEVLDSLQKSWIKLNPPLSAIAKAAIGQTQQDLQAS
DPFSILCCETLTQPMRRGRLLNSVAPLDRLKLPVAPNNDLPKRDDGANDTTRAGSLSWKR
LAPEDASEWLGVSAKARLATTEPRPLNYSIFAAEASAVSGMLLGVDAGLTPAAVPAAAEA
AATAKMTIGPFQDEEDAVVAYWRFEEGATAAEKQASGEAASLDGIECLDTSKRENTLRLL
GGAVNMVKSTAPVDRGEPGRIPEEFALRFPSSETSSASLPPSGWGAQCPVRPGSTLDVGT
TFDEDPYRREFTFEVWIRNYKLYEQLQKLVENGEEAPASLSGGVRQQLISRRRVDSLDDG
VKGGDVSGPANWELVIDEDDFLVLTFGSQQVRATQKLEHTGSQGWRHVAFTVDVSSPQRV
GLKLFIDARCVGESQTTPSSQTVSKPSKLLLGWRMQDYEMTEVRLWATARSADQLSDMRE
NYLSLAEAKRRMKIAIHQRNCICEKCVSRRAQSVAGAGAAGAPRLGLSLGTPLAAPSRQR
RVVPQAKPTQ
Download sequence
Identical sequences H3GL88
164328.JGI77113 jgi|Phyra1_1|77113|fgenesh1_pg.C_scaffold_22000084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]