SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 164756.Mmcs_0416 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164756.Mmcs_0416
Domain Number 1 Region: 45-282
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.07e-39
Family Glycosyl hydrolases family 16 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 164756.Mmcs_0416
Sequence length 283
Comment (Mycobacterium MCS)
Sequence
MDRRSAMLMFGVGVAAAALPVAKAGAQPVIGDTPPGPGVPEAGVPGLLFSDEFNGPAGAP
PNPASWFIVPARETIRNPVEWDKPFNMGRYVTDQEHVFQDGAGNLVIRATRGPGANIQEK
YASGKVIGNWRGGVGTTWEARIKLNCLTDGAWPAFWLINDNPVRGGEVDLVEWYGNRDWP
SGTTVHARLDGTQFQTHKHPVDSDWHTWRMTWQPQGMYFWKDYQPGMEPFFTVLANSLPE
WPFNDPGYTMAPVFNIAVGGSGGREPAGGNYPAEMLIDWIRVF
Download sequence
Identical sequences A0A1A0UUE3 A0A1X0GDM6 A1U9Y4
gi|126433017|ref|YP_001068708.1| 164756.Mmcs_0416 164757.Mjls_0404 189918.Mkms_0425 gi|119866480|ref|YP_936432.1| gi|108797396|ref|YP_637593.1| WP_011557842.1.20321 WP_011557842.1.3374 WP_011557842.1.37251 WP_011557842.1.44017 WP_011557842.1.47369 WP_011557842.1.73225

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]