SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 167542.P9515_02151 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  167542.P9515_02151
Domain Number 1 Region: 29-358
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.58e-63
Family AAT-like 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 167542.P9515_02151
Sequence length 369
Comment (Prochlorococcus marinus MIT 9515)
Sequence
MSEFNKINNLPPTPRKEIINMQSYSAPLENRRNLLRLDFNENTLGPSQKVYEAIKDIKLN
QISIYPEYNLLKNFLSHNYYESRQFDSEEIGLFNGADAVINAIFHSFGDRDEIFLTTNPT
FGYYSPCSEIQGMKKITCSYEGEHFLFPIKRFEEKIIKHKPKLIFICNPNNPTGTVLSAQ
EIIKLANLNKSSLIVVDELYEKFNGDSLLPKIDFQEIKNIVIIQSLSKTAGLAGLRIGFA
FGNKSIIQYINKVTGPYDVNSFAVTAALAALNDKSYIDNYVTEVNKARLFIEKKFESLSI
RTHFGAGNYFLIWPNQNPEILTRKMRERGILIREMKNKKDIENSVRVSIGTQEQMLRFWS
TYKELDLNN
Download sequence
Identical sequences A2BUG3
WP_011819538.1.83733 gi|123965450|ref|YP_001010531.1| 167542.P9515_02151

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]