SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 167542.P9515_02911 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  167542.P9515_02911
Domain Number 1 Region: 4-415
Classification Level Classification E-value
Superfamily PLP-dependent transferases 4.78e-176
Family GABA-aminotransferase-like 0.000000000485
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 167542.P9515_02911
Sequence length 423
Comment (Prochlorococcus marinus MIT 9515)
Sequence
MNILQNLKKSDPIISNLINSEKNRQETHLELIASENFASMAVMQAQGSVLTNKYAEGLPQ
KRYYGGCEFVDEIEELAIERAKQLFDADWANVQPHSGAQANAAVFLSLLNPGDTILGMDL
SHGGHLTHGSPVNMSGKWFNAVHYGVDKETNKLNFNVIRDIALATKPKLIICGYSAYPRT
IDFKSFRSIADEVGAFLMADIAHIAGLVASKLHPNPIPYCDVVTTTTHKTLRGPRGGLIL
CKDKEFGKKFDKSVFPGTQGGPLEHIIAAKAVAFGEALQPNFVNYSKQVIKNAKVLSSTL
INRGIDIVSGGTDNHIVLLDLRSINMTGKVADLLVSEVNITANKNTVPFDPESPFVTSGL
RLGTAALTTRGFNDEAFIEVGEIIADRLLNPDDLLIEKECKERVLSLCNSFPLYEAKLES
SIK
Download sequence
Identical sequences A2BUN9
gi|123965526|ref|YP_001010607.1| WP_011819610.1.83733 167542.P9515_02911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]