SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 167542.P9515_06811 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  167542.P9515_06811
Domain Number 1 Region: 184-360
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.19e-54
Family N-acetylmuramoyl-L-alanine amidase-like 0.0000707
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 167542.P9515_06811
Sequence length 364
Comment (Prochlorococcus marinus MIT 9515)
Sequence
MMSKFFFNKLFRCLSIFLLFNSSISPARSSSALAAWSLNSNGVLELRTKSNSKLKAYFQK
GGKNFGDRFWIDFPGELQTPRTIEGNGPIKEIRLGKPIKGKTRLVVEFSADNNNLKPLSW
RLVGIDQNTWKIKLFSLPKNSFQTIGEGLVSKSRINLKANKKLIKPRKTNYEFLQLPDIE
RNKFYVVLDPGHGGPDPGAIGIGGVKEADVVLDVSKRVRNLLSKKGVNVRMTRNKEVDLD
LPPRVSIANRTNADVFVSIHANASRGKRRDINGLETFYYTGWRGRLLAKKIQKQILKVSP
GSPDRGVRQGRFFVIKNTRMPAVLVEIGFLTGRLDARRLEKSIHRERIAYAITKGILEYL
SKAG
Download sequence
Identical sequences A2BVS9
167542.P9515_06811 gi|123965916|ref|YP_001010997.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]