SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 178306.PAE1161 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  178306.PAE1161
Domain Number 1 Region: 27-93
Classification Level Classification E-value
Superfamily SMAD/FHA domain 4.59e-18
Family FHA domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 178306.PAE1161
Sequence length 100
Comment (Pyrobaculum aerophilum)
Sequence
MFTVELYPALYLRAEGARRYRVNWYRVFGRSDFLWHPRHQFISRRHFAVGYEEGVYFVED
LGSTNGTFLNGVDIRGKGRARLQPGDVINVAGVLELAVEF
Download sequence
Identical sequences Q8ZXQ4
gi|18312443|ref|NP_559110.1| 178306.PAE1161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]