SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 188937.MA0027 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  188937.MA0027
Domain Number - Region: 45-89
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0699
Family PHD domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 188937.MA0027
Sequence length 428
Comment (Methanosarcina acetivorans)
Sequence
MGKGNIAIDKSMIKTIVDGKIIIPLPKVLVENRYYPMFSIFSPTQCDSCGSKLHVNSHHT
RFIISRYGTISLNVTYWLCPTCKKHYHDRVIGVQGSANYSSEYYDTQINVRYDGRCSLHN
SRRIGETYTEGVINVCGRAPCPTSLWLYEQKLAKLSKQELLNQGVSFEETLYVDGNWIKN
GWKKKLEEFIGTKLTKKEWKKMRYKSVYVVATKEKVILDFEVTERLPTIEALMPLFIRIK
NRFPEDKIKKIVSDEDKAIIGAVKMVFPEVTHSFCVFHQLKNVSKRYYEEFSSVEEIPDN
DKITYNEISQLILSDTVISAVAHIQKIREFNSDLELSEASHKAISYAEEIFSKNVSFLKK
GFTPETDNTMEQIFSLICDIVDKVRSFKTDNGLTNFCYNLFTFFNKRCFSTGKWKGFSPL
MRARFQYG
Download sequence
Identical sequences Q8TH30
188937.MA0027 188937.MA1038 188937.MA1896 188937.MA2104 188937.MA2378 188937.MA2634 188937.MA3493 188937.MA3761 gi|20088926|ref|NP_615001.1| gi|20089910|ref|NP_615985.1| gi|20090746|ref|NP_616821.1| gi|20090948|ref|NP_617023.1| gi|20091210|ref|NP_617285.1| gi|20091457|ref|NP_617532.1| gi|20092303|ref|NP_618378.1| gi|20092559|ref|NP_618634.1| WP_011020086.1.98848

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]