SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 188937.MA2735 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  188937.MA2735
Domain Number - Region: 45-89
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0699
Family PHD domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 188937.MA2735
Sequence length 428
Comment (Methanosarcina acetivorans)
Sequence
MGKGNIAIDKSMIKTIVDGKIIIPLPKVLVENRYYPMFSIFSPTQCDSCGSKLHVNSHHT
RFIISRYGTISLNVTYWLCPTCKKHYHDRVIGVQGSANYSSEYYDTQINVRYDGRCSLHN
SRRIGETYTEGVINVCGRAPCPTSLWLYEQKLAKLSKQELLNQGVSFEETLYVDGNWIKN
GWKKKLEEFIGTKLTKKEWKKMRYKSVYVVATKEKVILDFEVTERLPTIEALMPLFIRIK
NRFPEDKIKKIVSDEDKAIIGAVKMVFPEVTHSFCVFHQLKNVSKRYYEEFSSIEEIPDN
DKITYNEISQLILSDTVISAVAHIQKIREFNSDLELSEASHKAISYAEEIFSKNVSFLKK
GFTPETDNTMEQIFSLICDIVDKARSFKTDNGLTNFCYNLFTFFNKRCFSTGKWKGFSPL
MRARFQYG
Download sequence
Identical sequences Q8TMC5
gi|20091559|ref|NP_617634.1| 188937.MA2735 WP_011022694.1.98848

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]