SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 188937.MA3330 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  188937.MA3330
Domain Number 1 Region: 414-636
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 2.41e-52
Family DNA/RNA non-specific endonuclease 0.00067
Further Details:      
 
Domain Number 2 Region: 107-326
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 9.75e-31
Family Prokaryotic proteases 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 188937.MA3330
Sequence length 654
Comment (Methanosarcina acetivorans)
Sequence
MRSNIILVIYFNYFKLLCYDGGKDMLENARKEEQQRKASERYYSRQKAAEAEQPGERFRR
EIIRPLTEVRPIERRLIFLEPGDDLALERIIGKSDLVGISYLELGLLAARPVCRIQVVNP
FGRPEGYGTGFLVGPNLLLTNNHVLDTAELARKSFAEFEFEQDINGRRKTSKSFDLRPDE
VFVTDPDLDFTLVSVAPVATEGTELTDYGLLRLVEDTGKVRNGEYVSIIQHPEGGLKQCC
LRENEVVDLFDNWIHYLTDTQPGTSGSPVFNDQWLVVCLHHSGVPMKDAQGNILKTDGQP
YREGIDNPGTIAWVANEGVRISRIFQALESRSENEPMAAESLRRLRSQGTDPVGPAIITA
PETVPGTAMELGELPAEHYHLADGYNPDFLGYLHQLPLPKLADNLQSKVAKLKDGGEILN
YLHFSIVMNADRRLAFYTAANIDGKKLKKIKRDRDKWYFDPRLDQRYQAGPKLYKGNPLD
RGHLVRRLDPCWGPNARDAGEDTFHFTNCSPQHERLNQHDWLEVEDYILKTADNANVQIS
VFTGPVFREDDMIYRNEYLLPADFWKVVAFVNKNGKLSATAYLRTQKNYLESLEFFDDEF
KTWQVPVAQVEALTGLSFDLPTDADPMARAAAGKGLESQRVNIRRIRSAADIIL
Download sequence
Identical sequences Q8TKR8
WP_011023260.1.98848 gi|20092144|ref|NP_618219.1| 188937.MA3330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]