SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 188937.MA3639 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  188937.MA3639
Domain Number 1 Region: 279-351
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000824
Family Collagen-binding domain 0.0037
Further Details:      
 
Weak hits

Sequence:  188937.MA3639
Domain Number - Region: 102-183
Classification Level Classification E-value
Superfamily Aldehyde ferredoxin oxidoreductase, N-terminal domain 0.0275
Family Aldehyde ferredoxin oxidoreductase, N-terminal domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 188937.MA3639
Sequence length 744
Comment (Methanosarcina acetivorans)
Sequence
MKPNNRSLSHLLFILFTVCMILTSSGSAAPDPCISGLPLDTNETSPDEFCWDSTTFGGLY
YSANKHKDLVASEDWWGERLQYTETDGQYELGKNNPRNHVIGEDELVYSTRQFPNKYKVV
SELGLDANTTPSELGGMVYYKLPWFGKPYVAVENDATQLANLVIDQPGSDKKILKAGDVW
DLGKNYSLTVNQVDVEGNKVWFSLSKEGEELESGIVDADGTIENQLFTAKADFGDGNDQL
YFITYVDSVFMSATDSFAVFKYTWLIDKNDILIIKEGDEYQGFEVKEASESELVLKNSDS
ITLNLDKDVKNYFTDSWYFQTSDEGKGSTSPNGYVIYPAKELSKPGNYTLRGLPFDTNVA
SSDEFCWDSTTFGGLYYSANKHKDFVSSENWWGERLQYIETDGQYELGKNNPGNHVIGEG
ELVYSTRQFPNKYKVISELGLDANTTPSELGGMVYYKLPWFAKPYVAVENDATQLASLVI
DQSGSDKKMLKAGDVWDFGKGYSLTVNQVDVEGNKVWFSLYKEGEELESGIVDADGTVEN
QLFTAKADFGDGNDQLYFITYVDSVFLSSYYSFAVFKYTWLIDKDNILVIENGDEYQGFE
VKEASEAELVLKNSDSITLNLDKDAKNYFTDSWYFQTSDEGKGSTSLNGYVIYPATGVVI
EAEDAPESVENSTENLNMTQDSNESEIISSDYSPDASEVEDSENKNNSPEEETGEESSAK
LPGFEILVGVYGIAFCRVFIKRRN
Download sequence
Identical sequences Q8TJY7
188937.MA3639 MvR228 WP_011023547.1.98848 gi|20092439|ref|NP_618514.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]