SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 188937.MA3700 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  188937.MA3700
Domain Number 1 Region: 635-907
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 2.68e-42
Family Integrin alpha N-terminal domain 0.0096
Further Details:      
 
Domain Number 2 Region: 1582-1668
Classification Level Classification E-value
Superfamily PKD domain 3.27e-33
Family PKD domain 0.00016
Further Details:      
 
Domain Number 3 Region: 958-1082
Classification Level Classification E-value
Superfamily PKD domain 3.43e-32
Family PKD domain 0.00029
Further Details:      
 
Domain Number 4 Region: 1087-1171
Classification Level Classification E-value
Superfamily PKD domain 1.57e-31
Family PKD domain 0.0002
Further Details:      
 
Domain Number 5 Region: 457-543
Classification Level Classification E-value
Superfamily PKD domain 5.49e-28
Family PKD domain 0.00017
Further Details:      
 
Domain Number 6 Region: 542-622
Classification Level Classification E-value
Superfamily PKD domain 2.09e-27
Family PKD domain 0.00031
Further Details:      
 
Domain Number 7 Region: 371-457
Classification Level Classification E-value
Superfamily PKD domain 1.7e-26
Family PKD domain 0.00032
Further Details:      
 
Weak hits

Sequence:  188937.MA3700
Domain Number - Region: 1827-1878
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00145
Family Type I dockerin domain 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 188937.MA3700
Sequence length 1881
Comment (Methanosarcina acetivorans)
Sequence
MINISNKYVIYILPILLILIFASTSSALPTVAHDTIRGEMYVSSTANWDSKYSTNNFDVP
NGTVIFARYYVGVWASSDTRASISTTFNGHAFETNPSYYSTEMGVTWIPYDVVDYVLPGE
TNTATIDSASWGDGRQYGSTLVVVLKNESKPEIECWVAEGCDWLHYGDYVGYEVDNSTTY
FNGTVDLSNVQSASLYSTHLTGYNYEDFNGKSLSSPANSVSGDYFDYIRWDNIKPSLVTE
NQTVLVSRGEDSYCSPVFHALSIEYKAPDLLPVNLTPFLVSADTENIMTANIENIGNKSS
QSFNVSLVVNGNVVDTQQVSELAAGDSITVEFHWKPDGSTDAYSLTVVVDPENIVIESEE
SNNKFTSLVGITSATTPVANFSADKTSGDVPLTVNFTDLSANSPTSWAWDFENDGIIDST
EQNPSYTYSTPGTYTVNLTATNAGGSNSTAKVGYITASTIIPVADFTANNTSGNMPFTVQ
FTDMSTNAPTEWLWDFGDSASSTEQNPVHTYTAAGKYTVKLTAANVAGNDSEEKTDYITA
YISPVANFTATPTSGSAPLAVSFTDQSTNAPTSWVWDFGDDTSSTSQNPTHTYSASGTYT
VILTATNIAGTNTTTKIGYITVSDFRPIWTSKSEWSINIGNGVIPCFADLDGDGDYDLLR
GDRAGVTYAYENTGNASNPVWAAKSEWNLPDIGDYATPCSVDLDGDGDYDLMIGAKSGVT
YAYENIGNASSPVWSRKTTWDVSNVGKYTAPCSADLDGDGDYDLMIGEYYGTSYAYENTG
NKSSPEWTTKTTWNTPDVGYTSRQAIADLDGDGDNDLLIGNVYGYTYAYENTGTKSSPVW
AKKTTWDAPEIKNNAAPALADLDGDGDYDLLIGWASSGNSYAYENTAPLVGSKPDIIPTA
VTPPSGIVANTPCTIVATINNSGTGNTGTFNATLSVNGTVVDTQSISGISSDSSALVNFT
WTPEAAGNYSLIITADSENGIAESDEANNVLTVLVTVSAVSESPVANFTADVTSGTDPLT
VNFTDQSTGTPTSWFWDFGDGVNSTEQSPVHTYTAEGNYSVKLTVTNADGSDEGLKTDYI
TVSKSSIPVPEPVAAFTADVTNGSAPLTVNFTDQSTNSPTSWLWDFGDGANSTEQNPVHT
YSTEGTYSVNLTVTNEDGSDSELKTDYITVTQAGQVATNDLSISGIVNTVPASAVFARET
NPVKVLNVQNTGTATLSNISIAVYASDVSSGTVPVDTTTIASLAGDATTTVTLIDPTIRD
LEGGTVTYTAVVDPDNLIAETDETNNNKSSSAKPLRYNGYKGKGIYWEGGSNITTMHTFD
LQGNLLYSTQPDSAYQPVGWESRTETWTASDLPVPDGSTIEKAFLYVAYNWDQTPGGYPW
LNINFNGNALDNGNISTGNGTIYRDWSNFGAYADYEYGLCVYDVTDKFSSAGNSLVMTPV
GENKNALYPSTLVVVYGNDNETRKQIFINEECDELAYSLTGYGTTPEEATAYAPFTGMFI
DVEKVQNATLYSFAGSAGPEEGNLLFNGNIVATNAWQGSSNSGSPLVFDVKSYLNEAGNE
AGIQGTASGGMDALQQILVVEYPEETVAAPVANFSANVTEGEAPLPVQFTDQSTGTPTSW
FWDFGDGANSTEQNPVHTYSAAGNYTVNLTVENAAGTDFEVKSDYIEVTEASGSTVTLYF
DPASSSVSENESTEINLVASNFPAGLSGYNLTVSIDDPAIAEIVDIEYPSWALITQNSTL
PGTSIYMKTVDLEDSVKEGAADVVLATIKVSGKEKGSANLSIGVKRLEEDSGDPIEPALL
TGTIEVTLLSPLPDQEYAPKDLDGDGLYEDLTGNGEFSFVDIVAYFHNMDWIEENMPVEY
FDFNGNGRIDFDDVVDMFAMI
Download sequence
Identical sequences Q8TJS7
gi|20092500|ref|NP_618575.1| WP_011023607.1.98848 MvR232 188937.MA3700

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]