SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 188937.MA3735 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  188937.MA3735
Domain Number - Region: 8-44
Classification Level Classification E-value
Superfamily RING/U-box 0.0006
Family Zf-UBP 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 188937.MA3735
Sequence length 80
Comment (Methanosarcina acetivorans)
Sequence
MLRWSNMLKCYDCLEEGKDSEAVGVCIVCGKGLCMEHIQQVEFPMKGGGYPLPHKTLKKG
LPRMMCKECISSILGDGFCV
Download sequence
Identical sequences Q8TJP4
gi|20092533|ref|NP_618608.1| 188937.MA3735

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]