SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 189918.Mkms_4730 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  189918.Mkms_4730
Domain Number 1 Region: 108-224,252-280
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 2.89e-24
Family NodB-like polysaccharide deacetylase 0.01
Further Details:      
 
Weak hits

Sequence:  189918.Mkms_4730
Domain Number - Region: 426-502
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0475
Family Galectin (animal S-lectin) 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 189918.Mkms_4730
Sequence length 548
Comment (Mycobacterium KMS)
Sequence
MTATSTPRTPWRTRIVRASVRAAFALVAAALLAAPFGLAWYLHVRGLQVSEQFYTPASSL
AADQDALAETLRSELPDRAAPVVLAYHDIRPMTATEDQPDPAADPRHHLVVTPEAFDAQL
TALRAAGYTSITSDQYVDYLAGGEVPERSVLLTFDDGTHGLWTYADKILERHGMHAVSFL
ITGNVGAKRPYYLSWQEIERMADSGRWDFQSHTRKMHARLPIDAAGTLASEMTHRRWLFE
KNRPETLDEFEGKIRTDLLASVQDIVDHGLPRPTLFAFPFSDGYDDDRASSDPQAAATAL
TVVREIFAGAFNNAPPQPLPAGARAAAVGMTGRIELTVDSTVEGLLESVRAKTPVAPGHA
APSRRPDLWTRLSDDTEAPLRIQGRGVRFDGPGRWSGAAYGREATADWASYTATVTVGGL
AARGVENGALIARVGTGEEVSVQVSAKYARVSVGLGPAWKVLRDLPLRPGDRHTVTMEVS
PTAIGVVVDGSARMSVPAGGGPAEYGGIGLSSSRTTEAAPWPVFTDLSVAPGRDVPNVKA
GVGVPTRS
Download sequence
Identical sequences A1UM63
WP_011768381.1.20321 WP_011768381.1.47369 189918.Mkms_4730 gi|119870759|ref|YP_940711.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]