SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 190192.MK0158 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  190192.MK0158
Domain Number 1 Region: 44-161
Classification Level Classification E-value
Superfamily Sortase 1.24e-21
Family Sortase 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 190192.MK0158
Sequence length 162
Comment (Methanopyrus kandleri)
Sequence
MRLRYLIPGILLLAPSTTYLGYLAAKEVAYFMYHESVSIPDCELVIPKLGLRERINTTSP
DYGVYYEIMTPPPGKKGITVFYGHRTLFGSPFLHLDELKRGDKVIVYWFGSKYVYVVYDK
VVVSPDYVIDPDASNKDELWLVTCTPLSTARERLIVKCVRVG
Download sequence
Identical sequences Q8TYY3
gi|20093598|ref|NP_613445.1| 190192.MK0158

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]