SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 190485.XCC0851 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  190485.XCC0851
Domain Number 1 Region: 119-207,236-468
Classification Level Classification E-value
Superfamily Subtilisin-like 8.25e-73
Family Subtilases 0.00000279
Further Details:      
 
Domain Number 2 Region: 482-569
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000235
Family Collagen-binding domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 190485.XCC0851
Sequence length 580
Comment (Xanthomonas campestris ATCC 33913)
Sequence
MSTASLRKRTGSLTILGASALTSLLLAMPAFAGEVYLDGLATAQTHQKFIVTYKDGSTAL
ASPSALTTSLRTAARAVPAKAGKALGLNSVRRLALGPELVRADRALDRAEAETLMRQLAA
DPNVQSVEVDQILHATLTPNDTRLSEQWAFGTTNAGLNIRPAWDKATGSGTVVAVIDTGI
TSHADLNANILAGYDFISDATTARDGNGRDSNAADEGDWYAANECGAGIPAASSSWHGTH
VAGTVAAVTNNTTGVAGTAYGAKVVPVRVLGKCGGSLSDIADAIVWASGGTVSGIPANAN
PAEVINMSLGGGGSCSTTMQNAINGAVSRGTTVVVAAGNDASNVSGSLPANCANVIAVAA
TTSAGAKASYSNFGTGIDVSAPGSSILSTLNSGTTTPGSASYASYNGTSMASPHVAGVVA
LVQSVAPTALTPAAVETLLKNTARALPGACSGGCGAGIVNADAAVTAAINGGSGGGGGGG
NTLTNGTPVTGLGAATGAELNYTITVPAGSGTLTVTTSGGSGDADLYVRAGSAPTDSAYT
CRPYRSGNAETCTITAPSGTYYVRLKAYSTFSGVTLRASY
Download sequence
Identical sequences A0A0H2XC88 P23314
NP_636242.1.47755 WP_011036087.1.1732 WP_011036087.1.18295 WP_011036087.1.27778 WP_011036087.1.43481 WP_011036087.1.88278 gi|66769681|ref|YP_244443.1| 190485.XCC0851 314565.XC_3379 gi|21230325|ref|NP_636242.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]