SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 195103.CPF_0166 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  195103.CPF_0166
Domain Number 1 Region: 989-1101
Classification Level Classification E-value
Superfamily Collagen-binding domain 1.09e-28
Family Collagen-binding domain 0.0001
Further Details:      
 
Domain Number 2 Region: 863-975
Classification Level Classification E-value
Superfamily Collagen-binding domain 1.83e-28
Family Collagen-binding domain 0.00017
Further Details:      
 
Domain Number 3 Region: 773-858
Classification Level Classification E-value
Superfamily PKD domain 4.97e-17
Family PKD domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 195103.CPF_0166
Sequence length 1104
Comment (Clostridium perfringens ATCC 13124)
Sequence
MKKNLKRGELTKLKLVERWSATFTLAAFILFNSSFKVFAADKKIENSNNGQITREINADQ
ISKTELNNEVATDNNRPLGPSIAPSRARNNKIYTFDELNRMNYSDLVELIKTISYENVPD
LFNFNDGSYTFFSNRDRVQAIIYGLEDSGRTYTADDDKGIPTLVEFLRAGYYLGFYNKQL
SYLNTPQLKNECLPAMKAIQYNSNFRLGTKAQDGVVEALGRLIGNASADPEVINNCIYVL
SDFKDNIDKYGSNYSKGNAVFNLMKGIDYYTNSVIYNTKGYDAKNTEFYNRIDPYMERLE
SLCTIGDKLNNDNAWFVNNALYYTGRMGKFREDPSISQRALERAMKEYPYLSYQYIEAAN
DLDLNFGGKNSSGNDIDFNKIKADAREKYLPKTYTFDDGKFVVKAGDKVTEEKIKRLYWA
SKEVKAQFMRVVQNDKALEEGNPDDILTVVIYNSPEEYKLNRIINGFSTDNGGIYIENIG
TFFTYERTPEESIYTLEELFRHEFTHYLQGRYVVPGMWGQGEFYQEGVLTWYEEGTAEFF
AGSTRTDGIKPRKSVTQGLAYDRNNRMSLYDVLHAKYGSWDFYNYGFALSNYMYNNNIGM
FNKMTNYIKNNDVSGYKDYIASMSSDYGLNDKYQDYIDSLLNNIDNLDVPLVSDEYVNGH
EAKDINEITNDIKEVSNIKDLSSNVEKSQFFTTYDMRGTYVGERSQGEENDWKDMNSKLN
DILKELSKKSWNGYKTVTAYFVNHKVDENGNYVYDVVFHGMNTDTNTDVHVNKEPKAVIK
SDSSVIVEEEINFDGTESKDEDGEIKAYEWDFGDGEKSNEAKAAHKYNKTGEYEVKLTVT
DNNGGINTESKKIKVVEDKPVEVINESEPNNDFEKANQIAKSNMLVKGTLSEEDYSDKYY
FDVAKKGNVKITLNNLNSVGITWTLYKEGDLNNYVLYATGNDGTELKGEKTLEPGRYYLS
VYTYDNQSGAYTVNVKGKLKNEVKETEKDAIKEVENNNDFDKAMKVDSNSKIVGTLSNDD
LKDIYSIDIQNPSDLNIVVENLDNIKMNWLLYSADDLSNYVDYANADGNKLSNTCKLNPG
KYYLCVYQFENSGTGNYTINLQNK
Download sequence
Identical sequences A0A0H2YPK1
WP_011590092.1.50147 gi|110798785|ref|YP_694630.1| 195103.CPF_0166

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]