SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 197221.tll1713 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  197221.tll1713
Domain Number 1 Region: 118-287
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 1.14e-60
Family NadC C-terminal domain-like 0.00000947
Further Details:      
 
Domain Number 2 Region: 5-117
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase N-terminal domain-like 2.63e-28
Family NadC N-terminal domain-like 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 197221.tll1713
Sequence length 288
Comment (Thermosynechococcus elongatus)
Sequence
MNPRVSAYLPPWSVLDPLLDQWLQEDIGRGDRTTQALHLQDRQGKAHIRLKSQGVIAGLP
IVERVFQRLTTAVVFTYEQAEGAICEEPTIVARIAAPLETLLLGERLALNCLMRLSGIAT
LTHTYVQAIADLPTQLVDTRKTTPGLRLLEKYAVAVGGGVNHRFGLDDAILIKDNHIVAA
GGITAAVEKVRQASPFPLAIEVETETLEQVREALFLGVDVIMLDNMPIPEMTQAVAMIRA
EAPHIKIEASGNITLETLRPVALTGVDYISTSAMITRSPWLDFSLTIL
Download sequence
Identical sequences Q8DI77
NP_682503.1.97157 gi|22299256|ref|NP_682503.1| 197221.tll1713

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]