SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 197221.tll1774 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  197221.tll1774
Domain Number 1 Region: 393-572
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.85e-42
Family N-acetylmuramoyl-L-alanine amidase-like 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 197221.tll1774
Sequence length 577
Comment (Thermosynechococcus elongatus)
Sequence
MNGVSLSFLSAVIVGSLQPATAQGSLQVVYPPRQHTTSAPQIFFIGTAPPQVAVTLNGQV
IGDRSPAGHFAPSIPLQPGLNRITLQAGDQRLEFAITRTVPEIPTSPQPLEPTADLVRLP
NDIVCFTAAAPGDRAVEVQVGQHLLPLEPLPPQVQLPSNLAALIDQADGVTARPSLYRNC
LQLTQVGDYGPIQWRFASQRQLGARIRVAEPTHLPVVEVNRPFGGVARTGPSTDYSRLTP
LPVGTRARVRGQTGDWLHLDYGGWIRADEVRFLSSALPTTATIRSITSRQRSGWTEISFP
LDVPVPISIQQGDRQFTLTLHNTIPQTDIIRVDTDPVIQRLDWSPLDQQRVEYRFTLHHR
QQWGYRVAYEGNRLLLQLRHPPQLQQGTQPLRGIKILIDPGHGGPEDLGARGPDGTPEKV
VTFTLAKKLAPELERLGATVILTRTEDIDLDLLDRSLAIESAQPTLALSLHYNALPDAGD
ARNTQGIGAFWYHPQSHDLAVFLGNYLSQQLRRPQYGVFWNNLALTRPTIAPAVLLELGF
MIHPEEFEWIVNPQAQGELARTLAQGLLKWLQQATRP
Download sequence
Identical sequences Q8DI18
NP_682564.1.97157 gi|22299317|ref|NP_682564.1| 197221.tll1774

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]