SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 197221.tlr0431 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  197221.tlr0431
Domain Number 1 Region: 20-96
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit C 5.49e-21
Family F1F0 ATP synthase subunit C 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 197221.tlr0431
Sequence length 99
Comment (Thermosynechococcus elongatus)
Sequence
MISGNFVLSYYVSRKSTMNPLIASASVLAAALAIGLASLGPGLAQGNASGQALEGIARQP
EAEGKIRGTLLLSLAFMESLTIYGLVIALVLLFANPFAS
Download sequence
Identical sequences NP_681221.1.97157 gi|22297974|ref|NP_681221.1| 197221.tlr0431

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]