SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 197221.tlr0450 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  197221.tlr0450
Domain Number 1 Region: 4-367
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.01e-24
Family FAD/NAD-linked reductases, N-terminal and central domains 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 197221.tlr0450
Sequence length 457
Comment (Thermosynechococcus elongatus)
Sequence
MEPITVIGGGLAGTEAAWQIARAGLPVVLYEMRPQVASPAHHTAELAELVCSNSFGAKAS
DRATGLLHHELRALGSLIIATADRHQVPAGGALAVDRAHFSRELTETLENHPLVTVRREE
LPHLPESGIVVLATGPLTSEALSADLQCFTGLDYLSFFDAASPIVVGESINREVAFLASR
YDRGEAAYLNCPFSAEEYQRFWQALCEAKQAPLKDFERENAQFFEACLPVEELARRGVDT
LRFGPLKPVGLRDPRTGERPYAVAQLRQEDRHGQLWNLVGFQTNLRWGEQQRVFRMIPGL
EQAEFVRMGVMHRNTFLNAPKLLKASLQFRDRPTLLAAGQITGTEGYTAAAAGGWLAGTN
AARLARGLAPLVLPPTTMAGALFHYISTAESKTFQPMPPNFGILPPLEQPVRQKALRYAA
YRDRALKDLSTWATAMSLPLQPLALDGCDPAAVEAGA
Download sequence
Identical sequences P59109
NP_681240.1.97157 gi|22297993|ref|NP_681240.1| 197221.tlr0450 TeR128

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]