SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 203119.Cthe_0639 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  203119.Cthe_0639
Domain Number 1 Region: 13-88
Classification Level Classification E-value
Superfamily E set domains 1.59e-17
Family E-set domains of sugar-utilizing enzymes 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 203119.Cthe_0639
Sequence length 400
Comment (Clostridium thermocellum ATCC 27405)
Sequence
MKYPFYYCCDNLDIKSISVIGDFNNWDGGKNILKRHDDGTWMTEIELSPGKYRYKFLIND
SILFNDPNALIYTYDDKGGTASFIIIDESNKRIINTKPASLNIESYSFLSVDKELSYCEN
GERKCYKDKHSSIMLKIGFSDITGLHTVNAIWYAPNNEIHEIQESVLNDGEKNENRKNEA
LFQININDDTIAGEWKLQIFINGSLALEDSFTVELKQPEVLDKTALDDAAMLSADLEVPD
FLIEEDMQNEFEAPEFEVESNLQTNAEKEEISEEDLLGLFDDIKEIDMPEKDTSGNQKTP
APDETEMPADGNIMNLFDEIRISELKDEKAQDTENNTESTSKEAEESDSAIDELLELREF
IDSSQNSEKDSIESSGGKSGEEANEEDISDIFIDIKNRTD
Download sequence
Identical sequences A3DD45
203119.Cthe_0639 Cth-1196 WP_003516583.1.16390 WP_003516583.1.19387 WP_003516583.1.20586 WP_003516583.1.31213 WP_003516583.1.55520 WP_003516583.1.60145 WP_003516583.1.6636 WP_003516583.1.6965 gi|385778935|ref|YP_005688100.1| gi|125973157|ref|YP_001037067.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]