SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 203119.Cthe_0704 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  203119.Cthe_0704
Domain Number - Region: 79-175
Classification Level Classification E-value
Superfamily (Trans)glycosidases 0.00843
Family Family 1 of glycosyl hydrolase 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 203119.Cthe_0704
Sequence length 215
Comment (Clostridium thermocellum ATCC 27405)
Sequence
MIQIDDAGSGSFVGGTCIGVYRPETNEYFFEIIPVELYNKENFKKKLYLDAVVDIVEEAF
KALNVHKSETVEICRGYMFEKLRHWLDANGYCWYRTHISGRIQEIVEQNFMLYTMRLGVP
EAYLKYTKYPFHFHKLLRWVFADYNNRISLCKTGWQSWAKYEGIQREVHDDVMKYSHIFC
LKCGKHIRKGSRIKILRFVSNKEHFVYLHSKCHEC
Download sequence
Identical sequences A3DDB0
WP_003516196.1.16390 WP_003516196.1.19387 WP_003516196.1.20586 WP_003516196.1.31213 WP_003516196.1.55520 WP_003516196.1.60145 WP_003516196.1.6636 WP_003516196.1.6965 gi|385778868|ref|YP_005688033.1| Cth-667 gi|125973222|ref|YP_001037132.1| 203119.Cthe_0704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]