SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 203119.Cthe_0798 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  203119.Cthe_0798
Domain Number 1 Region: 11-224
Classification Level Classification E-value
Superfamily SGNH hydrolase 6.11e-34
Family Acetylhydrolase 0.012
Further Details:      
 
Domain Number 2 Region: 246-440
Classification Level Classification E-value
Superfamily SGNH hydrolase 3.36e-32
Family Acetylhydrolase 0.0087
Further Details:      
 
Domain Number 3 Region: 467-527
Classification Level Classification E-value
Superfamily Type I dockerin domain 6.38e-16
Family Type I dockerin domain 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 203119.Cthe_0798
Sequence length 528
Comment (Clostridium thermocellum ATCC 27405)
Sequence
MYKSKNLAAKVLSTLLIFITVISLINMEAPAASKTIKIMPVGDSCTEGMGGGEMGSYRTE
LYRLLTQAGLSIDFVGSQRSGPSSLPDKDHEGHSGWTIPQIASNINNWLNTHNPDVVFLW
IGGNDLLLNGNLNATGLSNLIDQIFTVKPNVTLFVADYYPWPEAIKQYNAVIPGIVQQKA
NAGKKVYFVKLSEIQFDRNTDISWDGLHLSEIGYKKIANIWYKYTIDILRALAGETQPNP
SPSSTPNTTKTIKIMPVGDSCTEGMGGGEMGSYRTELYRLLTQAGLSIDFVGSQRSGPSS
LPDKDHEGHSGWTIPQIASNINNWLNTHNPDVVFLWIGGNDLLLSGNVNATGLSNLIDQI
FTVKPNVTLFVADYYPWPEAVKQYNAVIPGIVQQKANAGKKVYFVKLSEIQFDRNTDISW
DGLHLSEIGYTKIANIWYKYTIDILKALAGQTQPTPSPSPTPTDSPLVKKGDVNLDGQVN
STDFSLLKRYILKVVDINSINVTNADMNNDGNINSTDISILKRILLRN
Download sequence
Identical sequences A3DDK4
203119.Cthe_0798 gi|385778772|ref|YP_005687937.1| WP_011837904.1.19387 WP_011837904.1.20586 WP_011837904.1.31213 WP_011837904.1.6636 gi|125973316|ref|YP_001037226.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]