SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 203119.Cthe_2193 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  203119.Cthe_2193
Domain Number 1 Region: 371-515
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.84e-31
Family Family 6 carbohydrate binding module, CBM6 0.00045
Further Details:      
 
Domain Number 2 Region: 38-314
Classification Level Classification E-value
Superfamily (Trans)glycosidases 5.49e-26
Family beta-glycanases 0.044
Further Details:      
 
Domain Number 3 Region: 518-651
Classification Level Classification E-value
Superfamily Ricin B-like lectins 7.13e-20
Family Ricin B-like 0.033
Further Details:      
 
Domain Number 4 Region: 884-946
Classification Level Classification E-value
Superfamily Type I dockerin domain 4.84e-16
Family Type I dockerin domain 0.00042
Further Details:      
 
Domain Number 5 Region: 645-735
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000778
Family Fibronectin type III 0.0025
Further Details:      
 
Domain Number 6 Region: 753-875
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000000893
Family Galactose-binding domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 203119.Cthe_2193
Sequence length 948
Comment (Clostridium thermocellum ATCC 27405)
Sequence
MGASIKTSIKIRTVAFVSIIAIALSILSFIPNRAYASPQRGRPRLNAARTTFVGDNGQPL
RGPYTSTEWTAAAPYDQIARVKELGFNAVHLYAECFDPRYPAPGSKAPGYAVNEIDKIVE
RTRELGLYLVITIGNGANNGNHNAQWARDFWKFYAPRYAKETHVLYEIHNEPVAWGPPYS
SSTANPPGAVDMEIDVYRIIRTYAPETPVLLFSYAVFGGKGGAAEALKDIRAFNKAVFGN
ENAVWTNEAVAFHGYAGWQETTIAVEELLKAGYPCFMTEYAGGAWGSGMGGLDVELTYEL
ERLGVSWLTFQYIPPTGVSDDVTKPEYFSALVENSGLSWTPDYGNWPAARGVYGNGGLAR
ETATWINNFLTGTTRIEAEDFDWGGNGVSYYDTDSVNVGGQYRPDEGVDIEKTSDTGGGY
NVGWISEGEWLEYTIRVRNPGYYNLSLRVAGISGSRVQVSFGNQDKTGVWELPATGGFQT
WTTATRQVFLGAGLQKLRINALSGGFNLNWIELSPISTGTIPDGTYKFLNRANGKTLQEV
TGNNSIITADYKGITEQHWKIQHIGGGQYRISSAGRGWNWNWWMGFGTVGWWGTGSSTCF
IISPTGDGYYRIVLVGDGTNLQISSGDPSKIEGKAFHGGANQQWAILPVSAPAFPTGLSA
VLDSSGNTANLTWNAAPGANSYNVKRSTKSGGPYTTIATNITSTNYTDTGVATGTKYYYV
VSAVSNGVETLNSAEAILQYPKLTGTVIGTQGSWNNIGNTIHKAFDGDLNTFFDGPTANG
CWLGLDFGEGVRNVITQIKFCPRSGYEQRMIGGIFQGANKEDFSDAVTLFTITSLPGSGT
LTSVDVDNPTGFRYVRYLSPDGSNGNIAELQFFGTPAGEENDDVHLGDINDDGNINSTDL
QMLKRHLLRSIRLTEKQLLNADTNRDGRVDSTDLALLKRYILRVITTL
Download sequence
Identical sequences A3DHG6
203119.Cthe_2193 gi|125974678|ref|YP_001038588.1| WP_003513669.1.16390 WP_003513669.1.31213 WP_003513669.1.60145

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]