SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 203122.Sde_3090 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  203122.Sde_3090
Domain Number 1 Region: 2-98
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000000000379
Family SMI1/KNR4-like 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 203122.Sde_3090
Sequence length 130
Comment (Saccharophagus degradans 2-40)
Sequence
MREFLETVENLNSQYASIEIDGELDSLSHNFWSAAEIENGKNVQADWDVPAHLIPFYGDW
HDLFCLDSDSGKIVSLNDEREIIYVWSCIKDFIASLSTTEVELTKKPEIVSFSLSPDLLE
KANEFKKKNT
Download sequence
Identical sequences Q21G32
gi|90022732|ref|YP_528559.1| WP_011469563.1.82451 203122.Sde_3090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]