SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 203122.Sde_3686 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  203122.Sde_3686
Domain Number 1 Region: 10-155
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 4.58e-25
Family SMI1/KNR4-like 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 203122.Sde_3686
Sequence length 157
Comment (Saccharophagus degradans 2-40)
Sequence
MELEITPIAGAISESAIRDFEENIGMPFPPDYREFMLKYNGGDPLKCVFKFQNATGPYSD
SIIRYFFAFSDDYDESIKHNHEAYTLADRVPKNILPIAEDPGGNIVCLSLAGDDVGKVYF
WDHEQEGLTEASATYENLELIANSFTEFVDGLEEESY
Download sequence
Identical sequences Q21ED8
WP_011470156.1.82451 gi|90023326|ref|YP_529153.1| 203122.Sde_3686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]