SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 203124.Tery_0666 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  203124.Tery_0666
Domain Number 1 Region: 204-541
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 3.14e-58
Family Integrin alpha N-terminal domain 0.017
Further Details:      
 
Domain Number 2 Region: 551-660
Classification Level Classification E-value
Superfamily CalX-like 9.02e-29
Family CalX-beta domain 0.00069
Further Details:      
 
Domain Number 3 Region: 661-773
Classification Level Classification E-value
Superfamily CalX-like 1.01e-23
Family CalX-beta domain 0.00089
Further Details:      
 
Domain Number 4 Region: 775-889
Classification Level Classification E-value
Superfamily Collagen-binding domain 6.41e-16
Family Collagen-binding domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 203124.Tery_0666
Sequence length 891
Comment (Trichodesmium erythraeum IMS101)
Sequence
MIDDGCTFPDVTFTVPDVNFMAQVSVEPLGAMGIIEEGWSEVRNNLAEFASSETFERDML
SVFGESTNVDLGRTIIDALVKGEDWPQINVVPAALMNGAAGGFDPLTGEVYLGDSLVEPL
SVVGSETREFDLVGVLTEEIAHSIEWKLNLTDTPGDEGEYLAALVNGDELSEGEIARLRG
EDDRREILNGTVIVEANSDLTFETQTFPTGDQPLGMAAADFNQDGFQDIVVANIGVANGI
SIFLGDGKGGVLTAFLSKLEGVVPALVTVGDMNRDGNQDIVTANFRNDSVTVLFGNGKGQ
FSSSSNFAVGDNPLELAVADVNRDGNLDVVTPNYYSNDVSVLLGNGDGTFMSATNFTTGG
SKPEGVVIKDINGDRNPDIMVSNVDSATVAVLPGNGDGTFGLPTSFPAGGKVYGITGKDL
NRDGKLDLVLPTLDPDGVSVMLGIGNGFFAFPTNLPVGSLPEHVAIEDLNGDRQLDLVVI
NRGSDNISVLLGKGKGLFEPAINFGVGEGPNIVVVEDFNNDGKKDIAVTNSEADTISILT
NTSKIAVADPNITISDTRITEGNKGRKNAKFTVTLDDASNKTVKVNYATANSSAKAGKDY
RKTTGTLTFKPGQTQKKINVPIFGDTIVEKNEKFQLNLSKPKNGKIKDKRGIATIRNDDK
NQPLLSIGDAQITEGDQGKKQLKFDVTLNTKVKKRVEVNYATADMTAKKGSDYQQTKGKL
IFKPNQKKKTITVPILGDTLNEDDEKFRVNLSRPKNAKLRDKRGVGLIKDNDRGGDQPGD
SFETAINLDILTGEQVVSDTIGFTEGIKRDTNDYFRFQTDKEGTFVLVLDDLLKNADVDL
YGSEQELINQSKNKGVKPESISTILDPDTYFLRVYPQGSSRTNYRLSVDLL
Download sequence
Identical sequences Q118G9
203124.Tery_0666 WP_011610498.1.43450 gi|113474517|ref|YP_720578.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]